Anti-GATA1 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.140~144 (R-L-S-P-D) derived from Human GATA1. |
Anti-GATA1 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.140~144 (R-L-S-P-D) derived from Human GATA1. |
Anti-GATA1 (Phospho-Ser142) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 142 (R-L-S(p)-P-D) derived from Human GATA1. |
Modifications | Phospho-specific |
Rabbit Polyclonal GATA1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 |
Rabbit Polyclonal GATA1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 |
Rabbit Polyclonal GATA1 (Ser142) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 around the phosphorylation site of Serine 142 |
Modifications | Phospho-specific |
Rabbit Polyclonal GATA1 (Ser310) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 around the phosphorylation site of Serine 310 |
Modifications | Phospho-specific |
Rabbit anti-GATA1 (Phospho-Ser142) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanGATA-1 around the phosphorylation site of serine 142 (R-L-SP-P-D). |
Modifications | Phospho-specific |
Goat Polyclonal Antibody against GATA1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DAEAYRHSPVFQ, from the internal region of the protein sequence according to NP_002040.1. |
Rabbit anti-GATA1 (Phospho-Ser310) polyclonal antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanGATA1 around the phosphorylation site of serine 310 (K-A-SP-G-K). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GATA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GATA1 antibody: synthetic peptide directed towards the N terminal of human GATA1. Synthetic peptide located within the following region: SGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCME |