Antibodies

View as table Download

Anti-GATA1 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.140~144 (R-L-S-P-D) derived from Human GATA1.

Anti-GATA1 (Phospho-Ser142) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 142 (R-L-S(p)-P-D) derived from Human GATA1.
Modifications Phospho-specific

Rabbit Polyclonal GATA1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA1

Rabbit Polyclonal GATA1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA1

Rabbit Polyclonal GATA1 (Ser142) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA1 around the phosphorylation site of Serine 142
Modifications Phospho-specific

Rabbit Polyclonal GATA1 (Ser310) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA1 around the phosphorylation site of Serine 310
Modifications Phospho-specific

Rabbit anti-GATA1 (Phospho-Ser142) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanGATA-1 around the phosphorylation site of serine 142 (R-L-SP-P-D).
Modifications Phospho-specific

Goat Polyclonal Antibody against GATA1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DAEAYRHSPVFQ, from the internal region of the protein sequence according to NP_002040.1.

Rabbit anti-GATA1 (Phospho-Ser310) polyclonal antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanGATA1 around the phosphorylation site of serine 310 (K-A-SP-G-K).
Modifications Phospho-specific

Rabbit Polyclonal Anti-GATA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA1 antibody: synthetic peptide directed towards the N terminal of human GATA1. Synthetic peptide located within the following region: SGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCME