Antibodies

View as table Download

Rabbit Polyclonal Anti-SOX9 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ

Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K).
Modifications Phospho-specific

SOX9 mouse monoclonal antibody, clone 3C10, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

SOX9 rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated

Rabbit Polyclonal SOX9 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SOX9

Rabbit Polyclonal SOX9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Feline, Goat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 225-275 of human SOX9 was used as the immunogen for this antibody.

Rabbit Polyclonal SOX-9 (Ser181) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SOX-9 around the phosphorylation site of Serine 181
Modifications Phospho-specific

Rabbit anti SOX-9 (pS181) Polyclonal Antibody

Applications Dot, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding the epitope –RKSVK- with a single phosphorylation site Ser181. This sequence is identical among human, rat, mouse, bovine, chicken, and dog.

Rabbit anti SOX-9 (paired S181) Polyclonal Antibody

Applications Dot, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding the epitope –RKSVK- without phosphorylation. This sequence is identical among human, rat, mouse, bovine, chicken, and dog.

Rabbit Polyclonal Anti-SOX9 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the N terminal of human SOX9. Synthetic peptide located within the following region: PCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKG

Rabbit anti SOX-9 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from internal sequence of Human SOX-9 protein. This sequence is identical among human, rat, mouse, bovine, chicken, and dog.

Carrier-free (BSA/glycerol-free) SOX9 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SOX9 mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SOX9 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SOX9 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SOX9 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SOX9 mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SOX9 mouse monoclonal antibody,clone 3G3, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

SOX9 mouse monoclonal antibody,clone 3G3, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

SOX9 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SOX9 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".