CLIC5 (91-191) mouse monoclonal antibody, clone 1E6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
CLIC5 (91-191) mouse monoclonal antibody, clone 1E6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-CLIC5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLIC5 antibody: synthetic peptide directed towards the C terminal of human CLIC5. Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |
Rabbit Polyclonal Anti-CLIC5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLIC5 antibody: synthetic peptide directed towards the C terminal of human CLIC5. Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |