CLIC5 Rabbit Polyclonal Antibody

CAT#: TA338580

Rabbit Polyclonal Anti-CLIC5 Antibody

Product Images

WB Suggested Anti-CLIC5 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that CLIC5 is expressed in Jurkat

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLIC5 antibody: synthetic peptide directed towards the C terminal of human CLIC5. Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: chloride intracellular channel 5
• Database Link:
  NP_058625
  Entrez Gene 53405 Human
  UniProt ID Q9NZA1
• Background: This gene encodes a member of the chloride intracellular channel (CLIC) family of chloride ion channels. The encoded protein associates with actin-based cytoskeletal structures and may play a role in multiple processes including hair cell stereocilia formation, myoblast proliferation and glomerular podocyte and endothelial cell maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
• Synonyms: DFNB102; DFNB103; MST130; MSTP130
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other