Antibodies

Jump to Filters
View as table Download
KCNK4 Rabbit Polyclonal Antibody
TA328664

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-K2P4.1 (TRAAK)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide NLAFIDESSDTQSERGC, corresponding to amino acid residues 343-359 of human K2P4.1 . Intracellular, C-terminus.
KCNK4 Rabbit Polyclonal Antibody
TA338723

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH
KCNK4 Rabbit Polyclonal Antibody
TA342055

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA