Antibodies

View as table Download

Rabbit Polyclonal Anti-PPM1A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPM1A antibody: synthetic peptide directed towards the middle region of human PPM1A. Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK

PPM1A mouse monoclonal antibody, clone 4E11, Purified

Applications ELISA, IHC, WB
Reactivities Human