Antibodies

Jump to Filters
View as table Download
PTPN5 Rabbit Polyclonal Antibody
TA349163

USD 484.00

5 Days

Rabbit Polyclonal Anti-RSPO3 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen RSPO3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human RSPO3.
PTPN5 Mouse Monoclonal Antibody
TA309823

USD 424.00

In Stock

Mouse Monoclonal STEP Antibody (23E5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTPN5 Rabbit Polyclonal Antibody
TA335980

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTPN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PTPN5 Antibody: synthetic peptide directed towards the middle region of human PTPN5. Synthetic peptide located within the following region: VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNE