Antibodies

Jump to Filters
View as table Download
NFkB Inducing Kinase NIK (MAP3K14) Rabbit Polyclonal Antibody
TA346370

USD 475.00

5 Days

Rabbit Polyclonal Anti-MAP3K14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K14 antibody: synthetic peptide directed towards the N terminal of human MAP3K14. Synthetic peptide located within the following region: SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
NFkB Inducing Kinase NIK (MAP3K14) Rabbit Polyclonal Antibody
TA336951

USD 424.00

5 Days

Rabbit Polyclonal NIK/MAP3K14 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human MAP3K14 protein (between residues 800-900) [UniProt Q99558]
NFkB Inducing Kinase NIK (MAP3K14) Rabbit Polyclonal Antibody
TA321611

USD 345.00

4 Weeks

Anti-MAP3K14 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human mitogen-activated protein kinase kinase kinase 14