Rabbit polyclonal anti-MAPK3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK3. |
Rabbit polyclonal anti-MAPK3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK3. |
Rabbit Polyclonal Anti-MAPK3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAPK3 Antibody: A synthesized peptide derived from human MAPK3 |
Rabbit Polyclonal Anti-MAPKAPK3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAPKAPK3 antibody: synthetic peptide directed towards the C terminal of human MAPKAPK3. Synthetic peptide located within the following region: KEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNN |
Rabbit Polyclonal Anti-MAPKAPK3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAPKAPK3 antibody: synthetic peptide directed towards the C terminal of human MAPKAPK3. Synthetic peptide located within the following region: PLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLN |