MAPKAP Kinase 3 (MAPKAPK3) Rabbit Polyclonal Antibody
Other products for "MAPKAPK3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MAPKAPK3 antibody: synthetic peptide directed towards the C terminal of human MAPKAPK3. Synthetic peptide located within the following region: PLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 43 kDa |
Gene Name | mitogen-activated protein kinase-activated protein kinase 3 |
Database Link | |
Background | MAPKAPK3 is a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This kinase was shown to be activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation. |
Synonyms | 3PK; MAPKAP-K3; MAPKAP3; MAPKAPK-3; MK-3 |
Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 93% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | MAPK signaling pathway, VEGF signaling pathway |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.