Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MAPK3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPK3 Antibody: A synthesized peptide derived from human MAPK3 |
Rabbit Polyclonal Anti-MAPKAPK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPKAPK3 antibody: synthetic peptide directed towards the C terminal of human MAPKAPK3. Synthetic peptide located within the following region: KEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNN |
Rabbit Polyclonal Anti-MAPKAPK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPKAPK3 antibody: synthetic peptide directed towards the C terminal of human MAPKAPK3. Synthetic peptide located within the following region: PLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLN |
MAPKAPK3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MAPKAPK3 |
MAPKAPK3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAPKAPK3 |
MAPKAPK3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human MAPKAPK3 (NP_004626.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MAPKAPK3