Antibodies

View as table Download

Rabbit polyclonal antibody to Cdk3 (cyclin-dependent kinase 3)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 238 of Cdk3 (Uniprot ID#Q00526)

Rabbit Polyclonal Anti-CDK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK3 antibody: synthetic peptide directed towards the C terminal of human CDK3. Synthetic peptide located within the following region: NLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRF