Antibodies

View as table Download

Rabbit Polyclonal ST2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ST2 antibody was raised against a synthetic peptide corresponding to 16 amino acids at the amino-terminus of mouse ST2. This peptide is common to all three known ST2 isoforms.

Rabbit Polyclonal Anti-IL1RL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL1RL1 antibody: synthetic peptide directed towards the N terminal of human IL1RL1. Synthetic peptide located within the following region: RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC

Rabbit Polyclonal IL1RL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 207-238 of human ST2V was used as immunogen, GenBank no BAA85894.

Anti-IL1RL1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human interleukin 1 receptor-like 1

Anti-IL1RL1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human interleukin 1 receptor-like 1