ST2 (IL1RL1) Rabbit Polyclonal Antibody

CAT#: TA342005

Rabbit Polyclonal Anti-IL1RL1 Antibody

Product Images

WB Suggested Anti-IL1RL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IL1RL1 antibody: synthetic peptide directed towards the N terminal of human IL1RL1. Synthetic peptide located within the following region: RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: interleukin 1 receptor like 1
• Database Link:
  NP_057316
  Entrez Gene 9173 Human
  UniProt ID Q01638
• Background: The protein encoded byThis gene is a member ofThe interleukin 1 receptor family. Studies ofThe similar gene in mouse suggested thatThis receptor can be induced by proinflammatory stimuli, and may be involved inThe function of helper T cells.This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing ofThis gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
• Synonyms: DER4; FIT-1; IL33R; ST2; ST2L; ST2V; T1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 79%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane