Antibodies

Jump to Filters
View as table Download
HIF-1 alpha (HIF1A) Mouse Monoclonal Antibody [Clone ID: H1alpha67]
TA309691

USD 479.00

2 Weeks

Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67)

Applications IHC, IP, WB
Reactivities Bovine, Ferret, Human, Mouse, Porcine, Primate, Rat, Sheep
Conjugation Unconjugated
SREBP1 (SREBF1) Rabbit Polyclonal Antibody
TA309881

USD 430.00

2 Weeks

Rabbit Polyclonal SREBP1 Antibody

Applications WB
Reactivities Bovine, Hamster, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956]
Calreticulin (CALR) Rabbit Polyclonal Antibody
TA309300

USD 355.00

5 Days

Rabbit Polyclonal anti-CALR Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep
Conjugation Unconjugated
Immunogen Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH
PRDM1 Mouse Monoclonal Antibody [Clone ID: 3H2-E8]
TA309819

USD 479.00

5 Days

Mouse Monoclonal Blimp-1 Antibody (3H2-E8)

Applications FC, WB
Reactivities Human, Mouse, Porcine
Conjugation Unconjugated
EGR2 Rabbit Polyclonal Antibody
TA336535

USD 424.00

5 Days

Rabbit Polyclonal EGR2 Antibody

Applications WB
Reactivities Human, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide made to a portion of human EGR2 (within residues 200-300). [Swiss-Prot# P11161]
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA336704

USD 424.00

5 Days

Rabbit Polyclonal HIF-1 alpha Antibody

Applications WB
Reactivities Human, Mouse, Porcine
Conjugation Unconjugated
Immunogen Genomic sequence made to an internal portion of human HIF-1 alpha (within residues 400-550). [Swiss-Prot# Q16665]
SOX2 Rabbit Polyclonal Antibody
TA336966

USD 402.00

5 Days

Rabbit Polyclonal SOX2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken, Feline, Porcine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 100-150 of human SOX2 was used as the immunogen for the antibody.
FLI1 Rabbit Polyclonal Antibody
TA335214

USD 310.00

5 Days

Rabbit Polyclonal Anti-FLI1 Antibody

Applications WB
Reactivities Human, Porcine
Conjugation Unconjugated
Immunogen The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1. Synthetic peptide located within the following region: MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINP
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA336484

USD 424.00

5 Days

Rabbit Polyclonal HIF-1 alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen Fusion protein containing amino acids 432-528 of human HIF-1 alpha [UniProt# Q16665]