HOXB6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 128-155 amino acids from the Central region of Human HOXB6 / HOX2B |
HOXB6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 128-155 amino acids from the Central region of Human HOXB6 / HOX2B |
Goat Anti-HOXB6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EPRKSDCAQDKS, from the internal region of the protein sequence according to NP_061825.2. |
Rabbit Polyclonal anti-HOXB6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXB6 antibody: synthetic peptide directed towards the N terminal of human HOXB6. Synthetic peptide located within the following region: ALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCN |