Rabbit Polyclonal POFUT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | POFUT1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human POFUT1. |
Rabbit Polyclonal POFUT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | POFUT1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human POFUT1. |
Rabbit polyclonal anti-POFUT1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POFUT1. |
POFUT1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 351-381 amino acids from the C-terminal region of human POFUT1 |
Rabbit Polyclonal Anti-POFUT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POFUT1 antibody: synthetic peptide directed towards the middle region of human POFUT1. Synthetic peptide located within the following region: RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP |