Antibodies

Jump to Filters
View as table Download
POFUT1 Rabbit Polyclonal Antibody
TA306631

USD 430.00

In Stock

Rabbit Polyclonal POFUT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen POFUT1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human POFUT1.
POFUT1 Rabbit Polyclonal Antibody
TA312714

USD 345.00

In Stock

Rabbit polyclonal anti-POFUT1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human POFUT1.
POFUT1 (C-term) Rabbit Polyclonal Antibody
AP53375PU-N

USD 450.00

2 Weeks

POFUT1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 351-381 amino acids from the C-terminal region of human POFUT1
POFUT1 Rabbit Polyclonal Antibody
TA342615

USD 375.00

5 Days

Rabbit Polyclonal Anti-POFUT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POFUT1 antibody: synthetic peptide directed towards the middle region of human POFUT1. Synthetic peptide located within the following region: RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP