Antibodies

Jump to Filters
View as table Download
IL22 Rabbit Polyclonal Antibody
TA326688

USD 430.00

5 Days

Rabbit Polyclonal IL-22 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-22 antibody was raised against a 17 amino acid peptide near the center of human IL-22
IL22 Mouse Monoclonal Antibody [Clone ID: 8F11E2]
TA337159

USD 424.00

5 Days

Mouse Monoclonal IL-22 Antibody (8F11E2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
IL22 Rabbit Polyclonal Antibody
TA338422

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL22 antibody: synthetic peptide directed towards the C terminal of human IL22. Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI