Antibodies

View as table Download

AMID (AIFM2) (C-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 326~356 amino acids from the C-terminal region of human AIFM2

Rabbit Polyclonal Anti-AIFM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIFM2 antibody: synthetic peptide directed towards the middle region of human AIFM2. Synthetic peptide located within the following region: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

Rabbit Polyclonal AMID Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 170-185 [VTLIHSQVALADKELL] of the 41 kDa human PRG3 protein. This sequence is 87% identical in mouse.

Rabbit polyclonal anti-AIFM2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AIFM2.