Antibodies

View as table Download

Rabbit polyclonal anti-CD200R1 (MOX2R) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MOX2R.

Rabbit Polyclonal Anti-CD200R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD200R1 antibody: synthetic peptide directed towards the N terminal of human CD200R1. Synthetic peptide located within the following region: NLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL