Germany
Japan
United Kingdom
China
Antibodies
View as table Download
HRH3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human HRH3 |
Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 299 and 389 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1) |
Goat Anti-histamine H3 receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SVTRAVSYRAQQGDT, from the internal region of the protein sequence according to NP_009163.2. |
Rabbit Polyclonal Anti-HRH3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HRH3 antibody is: synthetic peptide directed towards the C-terminal region of Human HRH3. Synthetic peptide located within the following region: LGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMV |
Rabbit Polyclonal Anti-HRH3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hrh3 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hrh3. Synthetic peptide located within the following region: VFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAI |
Rabbit Polyclonal Anti-HRH3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HRH3 |
Active filters
Target Symbol
- HRH3
Applications
- WB
Families
- Transmembrane