Antibodies

Jump to Filters
View as table Download
INSIG2 Rabbit Polyclonal Antibody
TA345661

USD 475.00

5 Days

Rabbit Polyclonal Anti-INSIG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INSIG1 antibody: synthetic peptide directed towards the middle region of human INSIG1. Synthetic peptide located within the following region: WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH
INSIG2 Rabbit Polyclonal Antibody
TA345660

USD 475.00

5 Days

Rabbit Polyclonal Anti-INSIG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INSIG2 antibody: synthetic peptide directed towards the N terminal of human INSIG2. Synthetic peptide located within the following region: MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ