INSIG2 Rabbit Polyclonal Antibody

CAT#: TA345661

Rabbit Polyclonal Anti-INSIG1 Antibody

Product Images

WB Suggested Anti-INSIG1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Muscle

• 

  Host: Rabbit; Target Name: WT1; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml; INSIG2 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-INSIG1 antibody: synthetic peptide directed towards the middle region of human INSIG1. Synthetic peptide located within the following region: WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: insulin induced gene 2
• Database Link:
  NP_057217
  Entrez Gene 51141 Human
  UniProt ID Q9Y5U4
• Background: Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: MGC26273
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 87%

Reference Data

• Protein Families: Transmembrane