Rabbit polyclonal anti-NPY2R antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NPY2R. |
Rabbit polyclonal anti-NPY2R antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NPY2R. |
NPY2R (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 25~54 amino acids from the N-terminal region of human NPY2R |
Rabbit Polyclonal anti-NPY2R Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NPY2R antibody is: synthetic peptide directed towards the N-terminal region of Human NPY2R. Synthetic peptide located within the following region: PIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVV |