Antibodies

View as table Download

Rabbit anti-PRNP Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRNP

Prion protein PrP (PRNP) mouse monoclonal antibody, clone EM-20, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Goat Polyclonal Antibody against Prion Protein (143-153)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SDYEDRYYREN, from the internal region of the protein sequence according to NP_000302.1; NP_898902.1.

Rabbit Polyclonal Prion protein Antibody

Applications WB
Reactivities Bovine, Sheep
Conjugation Unconjugated
Immunogen Amino acids 142-148 of BSE protein were used as the immunogen.

Rabbit Polyclonal Prion protein Antibody

Applications WB
Reactivities Bovine, Sheep, Avian
Conjugation Unconjugated
Immunogen Amino acids 162-170 of BSE protein were used as the immunogen.

Rabbit Polyclonal Prion protein Antibody

Applications WB
Reactivities Bovine, Sheep
Conjugation Unconjugated
Immunogen Amino acids 217-229 of BSE protein were used as the immunogen.

Rabbit Polyclonal Anti-PRNP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Prnp antibody is: synthetic peptide directed towards the middle region of Mouse Prnp. Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF