Antibodies

View as table Download

Rabbit polyclonal anti-p15 INK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human p15 INK antibody.

Rabbit Polyclonal Anti-p15 INK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p15 INK Antibody: A synthesized peptide derived from human p15 INK

Rabbit Polyclonal Anti-p15 INK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p15 INK Antibody: A synthesized peptide derived from human p15 INK

Rabbit Polyclonal Anti-CDKN2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDKN2B antibody: synthetic peptide directed towards the middle region of human CDKN2B. Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD