p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody

CAT#: TA330369

Rabbit Polyclonal Anti-CDKN2B Antibody

Product Images

WB Suggested Anti-CDKN2B Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDKN2B antibody: synthetic peptide directed towards the middle region of human CDKN2B. Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: cyclin-dependent kinase inhibitor 2B
• Database Link:
  NP_004927
  Entrez Gene 1030 Human
  UniProt ID P42772
• Background: CDKN2B's gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. CDKN2B is a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition.
• Synonyms: CDK4I; INK4B; MTS2; P15; p15INK4b; TP15
• Note: Immunogen sequence homology: Pig: 100%; Dog: 91%; Rabbit: 91%; Guinea pig: 83%; Mouse: 83%; Rat: 83%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway