Rabbit Polyclonal Anti-ABI3BP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABI3BP antibody is: synthetic peptide directed towards the C-terminal region of Human ABI3BP. Synthetic peptide located within the following region: PVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKR |
Rabbit Polyclonal Anti-ABI3BP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABI3BP antibody: synthetic peptide directed towards the N terminal of human ABI3BP. Synthetic peptide located within the following region: LINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQICPATETIVENLKP |
ABI3BP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 29-280 of human ABI3BP (NP_056244.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China