Antibodies

View as table Download

Rabbit Polyclonal Anti-C5AR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C5AR1 antibody: synthetic peptide directed towards the C terminal of human C5AR1. Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK

C5AR1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human C5AR1 (NP_001727.1).
Modifications Unmodified