Antibodies

View as table Download

EGLN1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human EGLN1

Rabbit Polyclonal Antibody against HIF Prolyl Hydroxylase 2

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal fragment of the human protein sequence of HIF prolyl hydroxylase 2 (residues 350-426).

Rabbit Polyclonal Anti-EGLN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGLN1 antibody: synthetic peptide directed towards the C terminal of human EGLN1. Synthetic peptide located within the following region: QPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF

Anti-EGLN1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 126 amino acids of human egl nine homolog 1 (C. elegans)

PHD2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-426 of human PHD2 (NP_071334.1).
Modifications Unmodified

EGLN1/EGLN2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human EGLN1/EGLN2
Modifications Unmodified