Antibodies

View as table Download

Rabbit Polyclonal Anti-FAH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG

Rabbit Polyclonal Anti-FAH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FAH antibody: synthetic peptide directed towards the N terminal of human FAH. Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT

Rabbit anti FAH (Fumarylacetoacetat Hydrolase) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A full length recombinant protein of FAH from mouse origin

FAH rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FAH

FAH Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-419 of human FAH (NP_000128.1).
Modifications Unmodified

FAH Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-419 of human FAH (NP_000128.1).
Modifications Unmodified