Antibodies

View as table Download

Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 293 and 387 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1)

HRH3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human HRH3

Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 299 and 389 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1)

Rabbit Polyclonal Anti-HRH3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HRH3 antibody is: synthetic peptide directed towards the C-terminal region of Human HRH3. Synthetic peptide located within the following region: LGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMV

Rabbit Polyclonal Anti-HRH3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Hrh3 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hrh3. Synthetic peptide located within the following region: VFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAI

Rabbit Polyclonal Anti-HRH3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HRH3

HRH3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human HRH3 (NP_009163.2).
Modifications Unmodified

HRH3 Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated