Antibodies

Jump to Filters
View as table Download
Hsp22 (HSPB8) Rabbit Polyclonal Antibody
TA308596

USD 415.00

5 Days

Rabbit Polyclonal antibody to HSP22 (heat shock 22kDa protein 8)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 134 and 196 of HSP22 (Uniprot ID#Q9UJY1)
Hsp22 (HSPB8) Goat Polyclonal Antibody
TA302835

USD 375.00

5 Days

Goat Polyclonal Antibody against HSPB8

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence NELPQDSQEVTCT, from the C Terminus of the protein sequence according to NP_055180.1.
Hsp22 (HSPB8) Rabbit Polyclonal Antibody
TA334525

USD 375.00

5 Days

Rabbit Polyclonal Anti-HSPB8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPB8 antibody: synthetic peptide directed towards the N terminal of human HSPB8. Synthetic peptide located within the following region: ADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDW
Hsp22 (HSPB8) Rabbit Polyclonal Antibody
TA334526

USD 375.00

5 Days

Rabbit Polyclonal Anti-HSPB8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPB8 antibody: synthetic peptide directed towards the middle region of human HSPB8. Synthetic peptide located within the following region: PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA
Hsp22 (HSPB8) Rabbit Polyclonal Antibody
TA377270

USD 220.00

3 Weeks

HSPB8/HSP22 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human HSPB8/HSP22 (NP_055180.1).
Modifications Unmodified