Antibodies

Jump to Filters
View as table Download
KCNK3 Rabbit Polyclonal Antibody
TA338524

USD 310.00

5 Days

Rabbit Polyclonal Anti-KCNK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK3 antibody: synthetic peptide directed towards the C terminal of human KCNK3. Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
KCNK3 Rabbit Polyclonal Antibody
TA351788

USD 345.00

In Stock

Rabbit Polyclonal Anti-KCNK3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNK3