Antibodies

View as table Download

Rabbit polyclonal anti-MEF2B antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MEF2B.

Rabbit Polyclonal Anti-MEF2B Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-MEF2B antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLL

MEF2B Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEF2B (NP_005910.1).
Modifications Unmodified

MEF2B Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEF2B (NP_005910.1).
Modifications Unmodified