Rabbit Polyclonal Anti-PHB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHB2 antibody: synthetic peptide directed towards the C terminal of human PHB2. Synthetic peptide located within the following region: KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK |
Rabbit Polyclonal Anti-PHB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHB2 antibody: synthetic peptide directed towards the N terminal of human PHB2. Synthetic peptide located within the following region: WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR |
Rabbit Polyclonal Antibody against PHB2
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken) |
| Immunogen | This REA (PHB2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-95 amino acids from the N-terminal region of human REA (PHB2). |
Prohibitin 2 (PHB2) Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-299 of human Prohibitin 2 (Prohibitin 2 (PHB2)) (NP_001138303.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
