Antibodies

Jump to Filters
View as table Download
RAB3D Rabbit Polyclonal Antibody
TA330003

USD 310.00

5 Days

Rabbit Polyclonal Anti-RAB3D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB3D antibody: synthetic peptide directed towards the C terminal of human RAB3D. Synthetic peptide located within the following region: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS
RAB3D Rabbit Polyclonal Antibody
TA380636

USD 220.00

3 Weeks

RAB3D Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-219 of human RAB3D (NP_004274.1).
Modifications Unmodified