Germany
Japan
United Kingdom
China
RAB3D Rabbit Polyclonal Antibody
Product Images
Other products for "RAB3D"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RAB3D antibody: synthetic peptide directed towards the C terminal of human RAB3D. Synthetic peptide located within the following region: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 24 kDa |
| Gene Name | RAB3D, member RAS oncogene family |
| Database Link | |
| Background | As a protein transport, RAB3D is probably involved in regulated exocytosis. |
| Synonyms | D2-2; GOV; RAB16; RAD3D |
| Note | Immunogen sequence homology: Human: 100%; Bovine: 86%; Rabbit: 86%; Mouse: 80%; Rat: 80% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.