Antibodies

View as table Download

Rabbit Polyclonal Anti-SMYD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the N terminal of human SMYD2. Synthetic peptide located within the following region: RLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAAL

SMYD2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMYD2

Rabbit Polyclonal Anti-SMYD2 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the middle region of human SMYD2. Synthetic peptide located within the following region: SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES

Rabbit Polyclonal Anti-SMYD2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMYD2

SMYD2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human SMYD2 (NP_064582.2).
Modifications Unmodified