SMYD2 Rabbit Polyclonal Antibody

CAT#: TA339738

Rabbit Polyclonal Anti-SMYD2 Antibody

Product Images

WB Suggested Anti-SMYD2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: SH-SYSY cell lysate SMYD2 is supported by BioGPS gene expression data to be expressed in SHSY5Y

• 

  Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Specifications

Product Data

• Applications: 10k-ChIP, WB
• Recommended Dilution: WB, CHIP
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the middle region of human SMYD2. Synthetic peptide located within the following region: SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: SET and MYND domain containing 2
• Database Link:
  NP_064582
  Entrez Gene 56950 Human
  UniProt ID Q9NRG4
• Background: The specific function of this protein remains unknown.SET domain-containing proteins, such as SMYD2, catalyze lysine methylation (Brown et al., 2006 [PubMed 16805913]). [supplied by OMIM]
• Synonyms: HSKM-B; KMT3C; ZMYND14
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome