Antibodies

View as table Download

Rabbit Polyclonal Anti-TRIM25 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM25 antibody: synthetic peptide directed towards the middle region of human TRIM25. Synthetic peptide located within the following region: TPSSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGA

Rabbit Polyclonal Anti-TRIM25 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM25 antibody: synthetic peptide directed towards the middle region of human TRIM25. Synthetic peptide located within the following region: LLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT

Rabbit Polyclonal TRIM25 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRIM25 antibody was raised against a 15 amino acid peptide from near the amino terminus of human TRIM25.

Rabbit polyclonal anti-ZNF147 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZNF147.

Rabbit Polyclonal TRIM25 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRIM25 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TRIM25.

Rabbit polyclonal TRIM25 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRIM25 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-306 amino acids from the Central region of human TRIM25.

TRIM25 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-400 of human TRIM25 (NP_005073.2).
Modifications Unmodified

TRIM25 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human TRIM25

TRIM25 Rabbit monoclonal Antibody

Applications IF, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated