Antibodies

Jump to Filters
View as table Download
VMA21 Rabbit Polyclonal Antibody
TA336068

USD 310.00

5 Days

Rabbit Polyclonal Anti-VMA21 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-VMA21 Antibody: synthetic peptide directed towards the N terminal of human LOC203547. Synthetic peptide located within the following region: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS