VMA21 Rabbit Polyclonal Antibody

CAT#: TA336068

Rabbit Polyclonal Anti-VMA21 Antibody

Product Images

WB Suggested Anti-VMA21 Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-VMA21 Antibody: synthetic peptide directed towards the N terminal of human LOC203547. Synthetic peptide located within the following region: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: VMA21 vacuolar H+-ATPase homolog (S. cerevisiae)
• Database Link:
  NP_001017980
  Entrez Gene 203547 Human
  UniProt ID Q3ZAQ7
• Background: The function remains unknown.
• Synonyms: MEAX; XMEA
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Pig: 92%; Bovine: 92%; Dog: 86%

Reference Data

• Protein Families: Transmembrane