Antibodies

Jump to Filters
View as table Download
VSIG1 Rabbit Polyclonal Antibody
TA333389

USD 375.00

5 Days

Rabbit Polyclonal Anti-VSIG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-VSIG1 Antibody: synthetic peptide directed towards the N terminal of human VSIG1. Synthetic peptide located within the following region: SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN
VSIG1 Rabbit Polyclonal Antibody
TA383273

USD 220.00

3 Weeks

VSIG1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-230 of human VSIG1 (NP_872413.1).
Modifications Unmodified