p53 (TP53) pSer392 rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Monkey, Rat |
Immunogen | Synthetic phosphopeptide corresponding to an amino acid sequence within p53 which includes phosphorylated Ser392. |
p53 (TP53) pSer392 rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Monkey, Rat |
Immunogen | Synthetic phosphopeptide corresponding to an amino acid sequence within p53 which includes phosphorylated Ser392. |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Rabbit Polyclonal p53 (Ser46) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human p53 around the phosphorylation site of Sersine 46. |
Modifications | Phospho-specific |
Mouse monoclonal anti-TP53 antibody (N-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TRP53 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRP53 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR |
Rabbit Polyclonal p53K372me1 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-p53K372me1 antibody: human p53 (tumor protein p53), methylated at K372, using a KLH-conjugated synthetic peptide. |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI5B2 (formerly 5B2)
Applications | FC, IF, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | FC, IF, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)
Applications | FC, IF, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)
Applications | FC, IF, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI9A7 (formerly 9A7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI7E2 (formerly 7E2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone DO-1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone DO-7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI7C5 (formerly 7C5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI9D11 (formerly 9D11)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI6C3 (formerly 6C3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI6C1 (formerly 6C1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI7A2 (formerly 7A2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI7F3 (formerly 7F3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI7D1 (formerly 7D1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI7A11 (formerly 7A11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TP53 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53 |
TP53 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
TP53 mouse monoclonal antibody, clone 3D5, Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
TP53 mouse monoclonal antibody, clone 3D5, HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TP53 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TP53 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
TP53 mouse monoclonal antibody, clone 2C4, Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
TP53 mouse monoclonal antibody, clone 2C4, HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TP53 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |