Antibodies

View as table Download

ALDH5A1 (485-496) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of Human ALDH5A1.

ALDH5A1 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen 22 amino acid peptide near the carboxy terminus of the human Aldh5A1

Rabbit Polyclonal Aldh5A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Aldh5A1 antibody was raised against a 22 amino acid peptide near the carboxy terminus of the human Aldh5A1.

Goat Anti-ALDH5A1 (aa 301-312) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-TGKILLHHAANS, from the internal region of the protein sequence according to NP_733936.1; NP_001071.1.

Rabbit Polyclonal Anti-ALDH5A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH5A1 antibody: synthetic peptide directed towards the middle region of human ALDH5A1. Synthetic peptide located within the following region: AFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM

Goat Anti-ALDH5A1 (aa 485-496), Biotinylated Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SQDPAQIWRVAE., from the internal region of the protein sequence according to NP_733936.1; NP_001071.1.