Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-DAPP1 / BAM32 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KLSQIRKQLNQGE, from the internal region (near C Terminus) of the protein sequence according to NP_055210.2. |
Rabbit Polyclonal Anti-DAPP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DAPP1 antibody: synthetic peptide directed towards the middle region of human DAPP1. Synthetic peptide located within the following region: SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG |
Rabbit Polyclonal Anti-DAPP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DAPP1 antibody: synthetic peptide directed towards the middle region of human DAPP1. Synthetic peptide located within the following region: KHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDD |
Carrier-free (BSA/glycerol-free) DAPP1 mouse monoclonal antibody,clone OTI2B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
DAPP1 mouse monoclonal antibody,clone OTI2B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DAPP1 mouse monoclonal antibody,clone OTI2B5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
DAPP1 mouse monoclonal antibody,clone OTI2B5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DAPP1 mouse monoclonal antibody,clone OTI2B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Active filters
Target Symbol
- DAPP1
Applications
- WB
Pathways
- B cell receptor signaling pathway