Rabbit polyclonal anti-CX3CL1 (Fractalkine) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed recombinant human Fractalkine |
Rabbit polyclonal anti-CX3CL1 (Fractalkine) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed recombinant human Fractalkine |
Rabbit Polyclonal CX3CL1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CX3CL1 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human CX3CL1 . |
CX3CL1 / fractalkine (aa214-226) Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Internal region (KTSEAPSTQDPST) |
Rabbit Polyclonal Anti-CX3CL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CX3CL1 antibody is: synthetic peptide directed towards the middle region of Human CX3CL1. Synthetic peptide located within the following region: APHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQ |