GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5 |
GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5 |
Rabbit Polyclonal Anti-GDF5 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP |