Antibodies

Jump to Filters
View as table Download
SPIRE2 (Center) Rabbit Polyclonal Antibody
AP54024PU-N

USD 450.00

2 Weeks

SPIRE2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 285-313 amino acids from the Central region of Human SPIRE2.
SPIRE2 Rabbit Polyclonal Antibody
TA342930

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPIRE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPIRE2 antibody: synthetic peptide directed towards the N terminal of human SPIRE2. Synthetic peptide located within the following region: EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG